• 28-02-2009, 20:09:57
    #1
    Birkaç aydır kullandığım bir ipucunu sizlerle paylaşacağım.
    Hepimiz mod rewrite / URL rewrite'ın ne olduğunu biliyoruz. Yapacağımız iş buna benziyor fakat gizli olacak.
    Server'dan default dökümanı değiştirme hakkınız varsa anasayfada açılan dosya ismini (Örnek : index.asp, default.asp, index.php) seoicinhedeflenenkelimeveyakelimeler.asp olarak değiştiriyoruz.
    Bunu yaparken ziyaretçilere bu durumu farkettirmemek için anasayfaya bağlanan alt sayfa linklerini default dökümana değil de domaine gönderiyoruz.
    Hiç zararı yok, özellikle subdomainlerimde çok faydasını gördüm.

    aranankelime.domain.com/aranankelimeninvaryasyonlari.asp

    burada aranan kelime varyasyonları ziyaretçiye gösterilmiyor fakat google güzel indeksliyor.

    denemek size kalmış.
  • 28-02-2009, 20:20:20
    #2
    Teşekkürler denemek gerekli
  • 28-02-2009, 20:34:17
    #3
    Kimlik doğrulama veya yönetimden onay bekliyor.
    helal olsun valla çok iyi fikir. denicem bunu
  • 28-02-2009, 20:42:17
    #4
    yeni yapacağınız default dökümanda kelimeler arasına tire (-) koyun. 20-25 harfi geçmeyin.
  • 28-02-2009, 21:08:01
    #5
    Teşekkürler denicem. Optmater ın seo konusundaki bilgilerine güveniyorum.. Yazdığın makakleler hoşuma gidiyor..
  • 28-02-2009, 23:40:41
    #6
    Üyeliği durduruldu
    deniyeceğim saolasın
  • 01-03-2009, 09:10:55
    #7
    Üyeliği durduruldu
    güzel fikir teşekkürler.
  • 01-03-2009, 09:30:15
    #8
    Üyeliği durduruldu
    çok sağol yararlı bilgi + repini verecem
  • 01-03-2009, 11:52:47
    #9
    tam olarak nasıl yapabiliriz?